Lineage for d5vrmd_ (5vrm D:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2426096Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2426097Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2426443Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 protein domains)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 2427028Protein Enoyl-ACP reductase [51791] (11 species)
  7. 2427148Species Mycobacterium tuberculosis, TB, gene InhA [TaxId:1773] [51793] (85 PDB entries)
  8. 3052240Domain d5vrmd_: 5vrm D: [352302]
    automated match to d4tzka_
    complexed with 9jj

Details for d5vrmd_

PDB Entry: 5vrm (more details), 2.5 Å

PDB Description: crystal structure of the inha from mycobacterium tuberculosis in complex with an12855, ebsi 4333.
PDB Compounds: (D:) Enoyl-[acyl-carrier-protein] reductase [NADH]

SCOPe Domain Sequences for d5vrmd_:

Sequence, based on SEQRES records: (download)

>d5vrmd_ c.2.1.2 (D:) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]}
glldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpakaplle
ldvqneehlaslagrvteaigagnkldgvvhsigfmpqtgmginpffdapyadvskgihi
saysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvareagky
gvrsnlvaagpirtlamsaivggalgeeagaqiqlleegwdqrapigwnmkdatpvaktv
callsdwlpattgdiiyadggahtqll

Sequence, based on observed residues (ATOM records): (download)

>d5vrmd_ c.2.1.2 (D:) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]}
glldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpakaplle
ldvqneehlaslagrvteaigagnkldgvvhsigfmpqpffdapyadvskgihisaysya
smakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvareagkygvrsnl
vaagpirtlamsaieagaqiqlleegwdqrapigwnmkdatpvaktvcallsdwlpattg
diiyadggahtqll

SCOPe Domain Coordinates for d5vrmd_:

Click to download the PDB-style file with coordinates for d5vrmd_.
(The format of our PDB-style files is described here.)

Timeline for d5vrmd_:

  • d5vrmd_ appears in periodic updates to SCOPe 2.07 starting on 2018-05-17