Lineage for d5zlma2 (5zlm A:183-356)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2771244Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins)
  6. 2771940Protein Spore coat protein A, CotA, middle domain [418913] (2 species)
  7. 2771955Species Bacillus subtilis [TaxId:224308] [419337] (8 PDB entries)
  8. 2771956Domain d5zlma2: 5zlm A:183-356 [352296]
    Other proteins in same PDB: d5zlma1, d5zlma3
    automated match to d1gska2
    complexed with cu, edo, gol; mutant

Details for d5zlma2

PDB Entry: 5zlm (more details), 1.7 Å

PDB Description: mutation in the trinuclear site of cota-laccase: h491c mutant, ph 8.0
PDB Compounds: (A:) spore coat protein a

SCOPe Domain Sequences for d5zlma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zlma2 b.6.1.3 (A:183-356) Spore coat protein A, CotA, middle domain {Bacillus subtilis [TaxId: 224308]}
klpsdeydvpllitdrtinedgslfypsapenpspslpnpsivpafcgetilvngkvwpy
leveprkyrfrvinasntrtynlsldnggdfiqigsdggllprsvklnsfslapaerydi
iidftayegesiilansagcggdvnpetdanimqfrvtkplaqkdesrkpkyla

SCOPe Domain Coordinates for d5zlma2:

Click to download the PDB-style file with coordinates for d5zlma2.
(The format of our PDB-style files is described here.)

Timeline for d5zlma2: