Lineage for d5tw8b2 (5tw8 B:316-383)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2409301Fold b.105: Penicillin-binding protein associated domain [69188] (1 superfamily)
    sandwich; 6 strands in 2 sheets
  4. 2409302Superfamily b.105.1: Penicillin-binding protein associated domain [69189] (3 families) (S)
  5. 2409332Family b.105.1.0: automated matches [231757] (1 protein)
    not a true family
  6. 2409333Protein automated matches [231758] (5 species)
    not a true protein
  7. 3052142Species Staphylococcus aureus [TaxId:93062] [352204] (5 PDB entries)
  8. 3052232Domain d5tw8b2: 5tw8 B:316-383 [352294]
    Other proteins in same PDB: d5tw8a1, d5tw8b1
    automated match to d3huma2
    complexed with ai8, na, zn

Details for d5tw8b2

PDB Entry: 5tw8 (more details), 1.72 Å

PDB Description: crystal structure of wild-type s. aureus penicillin binding protein 4 (pbp4) in complex with ceftaroline
PDB Compounds: (B:) Penicillin-binding protein 4

SCOPe Domain Sequences for d5tw8b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tw8b2 b.105.1.0 (B:316-383) automated matches {Staphylococcus aureus [TaxId: 93062]}
kyvkilskgeqringkkyyvendlydvlpsdfskkdyklvvedgkvhadyprefinkdyg
pptvevhq

SCOPe Domain Coordinates for d5tw8b2:

Click to download the PDB-style file with coordinates for d5tw8b2.
(The format of our PDB-style files is described here.)

Timeline for d5tw8b2:

  • d5tw8b2 appears in periodic updates to SCOPe 2.07 starting on 2018-05-17

View in 3D
Domains from same chain:
(mouse over for more information)
d5tw8b1