Lineage for d5xkab_ (5xka B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2546221Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2546222Protein automated matches [190417] (27 species)
    not a true protein
  7. 2547775Species Mycobacterium tuberculosis [TaxId:83332] [328012] (5 PDB entries)
  8. 3052229Domain d5xkab_: 5xka B: [352291]
    automated match to d5m07a_

Details for d5xkab_

PDB Entry: 5xka (more details), 1.6 Å

PDB Description: crystal structure of m.tuberculosis pkni kinase domain
PDB Compounds: (B:) Serine/threonine-protein kinase PknI

SCOPe Domain Sequences for d5xkab_:

Sequence, based on SEQRES records: (download)

>d5xkab_ d.144.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
alasgvtfagytvvrmlgcsamgevylvqhpgfpgwqalkvlspamaaddefrrrfqret
evaarlfhphilevhdrgefdgqlwiamdyvdgidatqhmadrfpavlpvgevlaivtav
agaldyahqrgllhrdvnpanvvltsqsagdqrilladfgiasqpsypapelsagadvdg
radqyalaltaihlfagappvdrshtgplqppklsafrpdlarldgvlsralatapadrf
gscrefadamneqagv

Sequence, based on observed residues (ATOM records): (download)

>d5xkab_ d.144.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
alasgvtfagytvvrmlgcsamgevylvqhpgfpgwqalkvlspamaaddefrrrfqret
evaarlfhphilevhdrgefdgqlwiamdyvdgidatqhmadrfpavlpvgevlaivtav
agaldyahqrgllhrdvnpanvvltsqrilladfgiasqpsypapelsagadvdgradqy
alaltaihlfagappvdrshtgplqppklsafrpdlarldgvlsralatapadrfgscre
fadamneqagv

SCOPe Domain Coordinates for d5xkab_:

Click to download the PDB-style file with coordinates for d5xkab_.
(The format of our PDB-style files is described here.)

Timeline for d5xkab_:

  • d5xkab_ appears in periodic updates to SCOPe 2.07 starting on 2018-05-17

View in 3D
Domains from other chains:
(mouse over for more information)
d5xkaa_