Lineage for d5nclb_ (5ncl B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2316812Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2318333Superfamily a.29.7: Mob1/phocein [101152] (2 families) (S)
    common fold is elaborated with additional short helices; contains a zinc-binding site
    automatically mapped to Pfam PF03637
  5. 3052071Family a.29.7.0: automated matches [352133] (1 protein)
    not a true family
  6. 3052072Protein automated matches [352134] (1 species)
    not a true protein
  7. 3052073Species Saccharomyces cerevisiae [TaxId:4932] [352135] (2 PDB entries)
  8. 3052227Domain d5nclb_: 5ncl B: [352289]
    automated match to d1pi1a_
    complexed with anp

Details for d5nclb_

PDB Entry: 5ncl (more details), 3.15 Å

PDB Description: crystal structure of the cbk1-mob2 kinase-coactivator complex with an ssd1 peptide
PDB Compounds: (B:) CBK1 kinase activator protein MOB2

SCOPe Domain Sequences for d5nclb_:

Sequence, based on SEQRES records: (download)

>d5nclb_ a.29.7.0 (B:) automated matches {Saccharomyces cerevisiae [TaxId: 4932]}
mflsepfvrtalvkgsfktivqlpkyvdlgewialnvfefftnlnqfygvvaeyvtpday
ptmnagphtdylwldannrqvslpasqyidlaltwinnkvndknlfptknglpfpqqfsr
dvqrimvqmfrifahiyhhhfdkivhlsleahwnsffshfisfakefkiidrkemapllp
liesfekqgki

Sequence, based on observed residues (ATOM records): (download)

>d5nclb_ a.29.7.0 (B:) automated matches {Saccharomyces cerevisiae [TaxId: 4932]}
mflsepfvrtalvkgsfktivqlpkyvdlgewialnvfefftnlnqfygvvaeyvtpdna
gphtdylwldanlpasqyidlaltwinnkvndknlfptknglpfpqqfsrdvqrimvqmf
rifahiyhhhfdkivhlsleahwnsffshfisfakefkiidrkemapllpliesfekqgk
i

SCOPe Domain Coordinates for d5nclb_:

Click to download the PDB-style file with coordinates for d5nclb_.
(The format of our PDB-style files is described here.)

Timeline for d5nclb_:

  • d5nclb_ appears in periodic updates to SCOPe 2.07 starting on 2018-05-17