Lineage for d5zlra1 (5zlr A:1-378)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2483347Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 2483348Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) (S)
  5. 2483853Family c.87.1.0: automated matches [191559] (1 protein)
    not a true family
  6. 2483854Protein automated matches [190965] (28 species)
    not a true protein
  7. 3050943Species Acinetobacter baumannii [TaxId:470] [351005] (3 PDB entries)
  8. 3052224Domain d5zlra1: 5zlr A:1-378 [352286]
    Other proteins in same PDB: d5zlra2, d5zlrb2
    automated match to d4zhtd_
    complexed with li, so4

Details for d5zlra1

PDB Entry: 5zlr (more details), 2 Å

PDB Description: structure of neuc
PDB Compounds: (A:) GDP/UDP-N,N'-diacetylbacillosamine 2-epimerase (Hydrolyzing)

SCOPe Domain Sequences for d5zlra1:

Sequence, based on SEQRES records: (download)

>d5zlra1 c.87.1.0 (A:1-378) automated matches {Acinetobacter baumannii [TaxId: 470]}
mkkiavftgtraeygllywlmrdiqqdpelelqilatamhyspehgetwktivkdgfeit
esvemllssdtssavvksmgvgllgfadalkrmqpdvlvvlgdrfealavtqaalimhvp
vahlhggeitegaydesirhaitkmsnihfaaaeeykkriiqlgeqpervfnvgalgldh
iqrttfksiselselydfdfskpyflityhpetnlleenvaplfdalkqindvnfifsyp
nadngntnivkamldlkaqlpdrvllvksfgiqnylsvlknalamvgnsssglseapalq
vptvnigdrqkgrlrcesildvrldeneivealqkainfpkdqlsqvvpplglgntsqki
ievikttdfkkkapfydl

Sequence, based on observed residues (ATOM records): (download)

>d5zlra1 c.87.1.0 (A:1-378) automated matches {Acinetobacter baumannii [TaxId: 470]}
mkkiavftgtraeygllywlmrdiqqdpelelqilatamhyspehgetwktivkdgfeit
esvemllssdtssavvksmgvgllgfadalkrmqpdvlvvlgdrfealavtqaalimhvp
vahlhggeitegaydesirhaitkmsnihfaaaeeykkriiqlgeqpervfnvgalgldh
iqrttfksiselselydfdfskpyflityhpetnlleenvaplfdalkqindvnfifsyp
nadngntnivkamldlkaqlpdrvllvksfgiqnylsvlknalamvgnsssglseapalq
vptvnigdrqkgrlrcesildvrldeneivealqkainfpplglgntsqkiievikttdf
kkkapfydl

SCOPe Domain Coordinates for d5zlra1:

Click to download the PDB-style file with coordinates for d5zlra1.
(The format of our PDB-style files is described here.)

Timeline for d5zlra1:

  • d5zlra1 appears in periodic updates to SCOPe 2.07 starting on 2018-05-17

View in 3D
Domains from same chain:
(mouse over for more information)
d5zlra2