Lineage for d5xmoa_ (5xmo A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2366402Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2366403Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2366404Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 protein domains)
    mono-domain proteins
  6. 2366953Protein automated matches [190545] (8 species)
    not a true protein
  7. 2366954Species Achromobacter cycloclastes [TaxId:223] [188032] (6 PDB entries)
  8. 3052223Domain d5xmoa_: 5xmo A: [352285]
    automated match to d2jkwa_
    complexed with cu

Details for d5xmoa_

PDB Entry: 5xmo (more details), 1.19 Å

PDB Description: x-ray crystal structure of pseudoazurin met16phe/thr36lys variant
PDB Compounds: (A:) pseudoazurin

SCOPe Domain Sequences for d5xmoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xmoa_ b.6.1.1 (A:) automated matches {Achromobacter cycloclastes [TaxId: 223]}
adfevhmlnkgkdgafvfepaslkvapgdtvtfipkdkghnvetikgmipdgaeafkski
nenykvtftapgvygvkctphygmgmvgvvqvgdapanleavkgaknpkkaqerldaala
algn

SCOPe Domain Coordinates for d5xmoa_:

Click to download the PDB-style file with coordinates for d5xmoa_.
(The format of our PDB-style files is described here.)

Timeline for d5xmoa_:

  • d5xmoa_ appears in periodic updates to SCOPe 2.07 starting on 2018-05-17