Lineage for d5np2b1 (5np2 B:64-120)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2376890Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2377019Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2377020Family b.34.2.1: SH3-domain [50045] (40 protein domains)
  6. 2377400Protein automated matches [190043] (6 species)
    not a true protein
  7. 2377424Species Human (Homo sapiens) [TaxId:9606] [187799] (31 PDB entries)
  8. 3052220Domain d5np2b1: 5np2 B:64-120 [352282]
    Other proteins in same PDB: d5np2a2, d5np2b2
    automated match to d1fyna_

Details for d5np2b1

PDB Entry: 5np2 (more details), 1.6 Å

PDB Description: abl1 sh3 ptyr89/134
PDB Compounds: (B:) Tyrosine-protein kinase ABL1

SCOPe Domain Sequences for d5np2b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5np2b1 b.34.2.1 (B:64-120) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nlfvalydfvasgdntlsitkgeklrvlgynhngewceaqtkngqgwvpsnyitpvn

SCOPe Domain Coordinates for d5np2b1:

Click to download the PDB-style file with coordinates for d5np2b1.
(The format of our PDB-style files is described here.)

Timeline for d5np2b1:

  • d5np2b1 appears in periodic updates to SCOPe 2.07 starting on 2018-05-17

View in 3D
Domains from same chain:
(mouse over for more information)
d5np2b2