SCOPe 2.08: Domain d5zlja1: 5zlj A:2-182

Lineage for d5zlja1 (5zlj A:2-182)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins)

6. Protein Spore coat protein A, CotA, N- and C-terminal domain [418912] (2 species)

7. Species Bacillus subtilis [TaxId:224308] [419336] (8 PDB entries)

8. Domain d5zlja1: 5zlj A:2-182 [352278]
   Other proteins in same PDB: d5zlja2
   automated match to d3zdwa1
   complexed with cu, edo, gol

Details for d5zlja1

PDB Entry: 5zlj, 1.96 Å

PDB Description: crystal structure of cota native enzyme, ph8.0

PDB Compounds: (A:) spore coat protein a

SCOPe Domain Sequences for d5zlja1:

Sequence, based on SEQRES records:

>d5zlja1 b.6.1.3 (A:2-182) Spore coat protein A, CotA, N- and C-terminal domain {Bacillus subtilis [TaxId: 224308]}
tlekfvdalpipdtlkpvqqskektyyevtmeecthqlhrdlpptrlwgynglfpgptie
vkrnenvyvkwmnnlpsthflpidhtihhsdsqheepevktvvhlhggvtpddsdgypea
wfskdfeqtgpyfkrevyhypnqqrgailwyhdhamaltrlnvyaglvgayiihdpkekr
l

Sequence, based on observed residues (ATOM records):

>d5zlja1 b.6.1.3 (A:2-182) Spore coat protein A, CotA, N- and C-terminal domain {Bacillus subtilis [TaxId: 224308]}
tlekfvdalpipdtlkpvqqskektyyevtmeecthqlhrdlpptrlwgynglfpgptie
vkrnenvyvkwmnnlpsthflpidhtihhsheepevktvvhlhggvtpddsdgypeawfs
kdfeqtgpyfkrevyhypnqqrgailwyhdhamaltrlnvyaglvgayiihdpkekrl

Timeline for d5zlja1:

• d5zlja1 first appeared in SCOPe 2.07