Lineage for d5vqka1 (5vqk A:265-513)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2335122Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2335123Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2336455Family a.123.1.0: automated matches [191623] (1 protein)
    not a true family
  6. 2336456Protein automated matches [191142] (6 species)
    not a true protein
  7. 2336469Species Human (Homo sapiens) [TaxId:9606] [189274] (69 PDB entries)
  8. 3052208Domain d5vqka1: 5vqk A:265-513 [352270]
    Other proteins in same PDB: d5vqka2
    automated match to d1xdkb_
    complexed with 9gv

Details for d5vqka1

PDB Entry: 5vqk (more details), 3.1 Å

PDB Description: x-ray co-structure of nuclear receptor ror-gammat ligand binding domain with a inverse agonist and src2 peptide
PDB Compounds: (A:) Nuclear receptor ROR-gamma, SRC2 chimera

SCOPe Domain Sequences for d5vqka1:

Sequence, based on SEQRES records: (download)

>d5vqka1 a.123.1.0 (A:265-513) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhl
teaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkygg
melfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqy
nlelafhhhlckthrqsilaklppkgklrslcsqhverlqifqhlhpivvqaafpplyke
lfsgggekh

Sequence, based on observed residues (ATOM records): (download)

>d5vqka1 a.123.1.0 (A:265-513) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhl
teaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkygg
melfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqy
nlelafhhhlckthrqsilaklppkgklrslcsqhverlqifqhlhpivvqaafpplyke
lfsgkh

SCOPe Domain Coordinates for d5vqka1:

Click to download the PDB-style file with coordinates for d5vqka1.
(The format of our PDB-style files is described here.)

Timeline for d5vqka1:

  • d5vqka1 appears in periodic updates to SCOPe 2.07 starting on 2018-05-17

View in 3D
Domains from same chain:
(mouse over for more information)
d5vqka2