Lineage for d5nt1j_ (5nt1 J:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2566512Fold d.299: Ns1 effector domain-like [143020] (1 superfamily)
    beta-X-beta(5)-alpha-beta-alpha; 2 layers: a/b; bifurcated beta-sheet; order 23654[1,7]
  4. 2566513Superfamily d.299.1: Ns1 effector domain-like [143021] (1 family) (S)
    automatically mapped to Pfam PF00600
  5. 2566514Family d.299.1.1: Ns1 effector domain-like [143022] (2 protein domains)
    C-terminal part of Pfam PF00600
  6. 2566519Protein automated matches [190936] (6 species)
    not a true protein
  7. 3052119Species Influenza a virus (strain a/puerto rico/8/1934 h1n1) [TaxId:211044] [352181] (1 PDB entry)
  8. 3052197Domain d5nt1j_: 5nt1 J: [352259]
    automated match to d2gx9a1

Details for d5nt1j_

PDB Entry: 5nt1 (more details), 2.82 Å

PDB Description: complex of influenza a ns1 effector domain with trim25 coiled coil
PDB Compounds: (J:) Non-structural protein 1

SCOPe Domain Sequences for d5nt1j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nt1j_ d.299.1.1 (J:) automated matches {Influenza a virus (strain a/puerto rico/8/1934 h1n1) [TaxId: 211044]}
asryltdmtleemsrewsmlipkqkvagplcirmdqaimdkniilkanfsvifdrletli
llrafteegaivgeisplpslpghtaedvknavgvligglewndntvrvsetlqrfawr

SCOPe Domain Coordinates for d5nt1j_:

Click to download the PDB-style file with coordinates for d5nt1j_.
(The format of our PDB-style files is described here.)

Timeline for d5nt1j_:

  • d5nt1j_ appears in periodic updates to SCOPe 2.07 starting on 2018-05-17