Lineage for d5v3ca_ (5v3c A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2425361Superfamily c.1.20: tRNA-guanine transglycosylase [51713] (1 family) (S)
  5. 2425362Family c.1.20.1: tRNA-guanine transglycosylase [51714] (2 proteins)
  6. 2425373Protein Queosine tRNA-guanine transglycosylase [51715] (3 species)
    contains zinc-binding subdomain
  7. 2425402Species Zymomonas mobilis [TaxId:542] [51716] (117 PDB entries)
    Uniprot P28720
  8. 3052193Domain d5v3ca_: 5v3c A: [352255]
    automated match to d5lpta_
    protein/RNA complex; complexed with amh, dms, peg, pge, zn

Details for d5v3ca_

PDB Entry: 5v3c (more details), 1.42 Å

PDB Description: crystal structure of tgt in complex with 4-(aminomethane)cyclohexane- 1-carboxylic acid
PDB Compounds: (A:) Queuine tRNA-ribosyltransferase

SCOPe Domain Sequences for d5v3ca_:

Sequence, based on SEQRES records: (download)

>d5v3ca_ c.1.20.1 (A:) Queosine tRNA-guanine transglycosylase {Zymomonas mobilis [TaxId: 542]}
drprfsfsiaaregkartgtiemkrgvirtpafmpvgtaatvkalkpetvratgadiilg
ntyhlmlrpgaeriaklgglhsfmgwdrpiltdsggyqvmslssltkqseegvtfkshld
gsrhmlspersieiqhllgsdivmafdectpypatpsraassmersmrwakrsrdafdsr
keqaenaalfgiqqgsvfenlrqqsadalaeigfdgyavgglavgegqdemfrvldfsvp
mlpddkphylmgvgkpddivgavergidmfdcvlptrsgrngqaftwdgpinirnarfse
dlkpldsechcavcqkwsrayihhlirageilgamlmtehniafyqqlmqkirdsisegr
fsqfaqdfraryfar

Sequence, based on observed residues (ATOM records): (download)

>d5v3ca_ c.1.20.1 (A:) Queosine tRNA-guanine transglycosylase {Zymomonas mobilis [TaxId: 542]}
drprfsfsiaaregkartgtiemkrgvirtpafmpvgtaatvkalkpetvratgadiilg
ntyhlmlrpgaeriaklgglhsfmgwdrpiltdsggyqvmslstkqseegvtfkshldgs
rhmlspersieiqhllgsdivmafdectpypatpsraassmersmrwakrsrdafdsrke
qaenaalfgiqqgsvfenlrqqsadalaeigfdgyavgglavgegqdemfrvldfsvpml
pddkphylmgvgkpddivgavergidmfdcvlptrsgrngqaftwdgpinirnarfsedl
kpldsechcavcqkwsrayihhlirageilgamlmtehniafyqqlmqkirdsisegrfs
qfaqdfraryfar

SCOPe Domain Coordinates for d5v3ca_:

Click to download the PDB-style file with coordinates for d5v3ca_.
(The format of our PDB-style files is described here.)

Timeline for d5v3ca_:

  • d5v3ca_ appears in periodic updates to SCOPe 2.07 starting on 2018-05-17