Lineage for d5o4gc2 (5o4g C:166-322)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2581531Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2582446Superfamily g.3.9: Growth factor receptor domain [57184] (2 families) (S)
  5. 2582517Family g.3.9.0: automated matches [232406] (1 protein)
    not a true family
  6. 2582518Protein automated matches [232407] (3 species)
    not a true protein
  7. 2582519Species Human (Homo sapiens) [TaxId:9606] [232408] (14 PDB entries)
  8. 3052181Domain d5o4gc2: 5o4g C:166-322 [352243]
    Other proteins in same PDB: d5o4ga1, d5o4ga2, d5o4gc1, d5o4gc3
    automated match to d1n8zc3
    complexed with bma, man, nag

Details for d5o4gc2

PDB Entry: 5o4g (more details), 3 Å

PDB Description: her2 in complex with fab mf3958
PDB Compounds: (C:) Receptor tyrosine-protein kinase erbB-2

SCOPe Domain Sequences for d5o4gc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5o4gc2 g.3.9.0 (C:166-322) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rsrachpcspmckgsrcwgessedcqsltrtvcaggcarckgplptdccheqcaagctgp
khsdclaclhfnhsgicelhcpalvtyntdtfesmpnpegrytfgascvtacpynylstd
vgsctlvcplhnqevtaedgtqrcekcskpcarvcyg

SCOPe Domain Coordinates for d5o4gc2:

Click to download the PDB-style file with coordinates for d5o4gc2.
(The format of our PDB-style files is described here.)

Timeline for d5o4gc2:

  • d5o4gc2 appears in periodic updates to SCOPe 2.07 starting on 2018-05-17