Lineage for d5o4gc1 (5o4g C:1-165)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2435068Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 2435137Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 2435341Family c.10.2.0: automated matches [191489] (1 protein)
    not a true family
  6. 2435342Protein automated matches [190787] (11 species)
    not a true protein
  7. 2435351Species Human (Homo sapiens) [TaxId:9606] [188042] (16 PDB entries)
  8. 3052180Domain d5o4gc1: 5o4g C:1-165 [352242]
    Other proteins in same PDB: d5o4ga1, d5o4ga2, d5o4gc2
    automated match to d1n8zc1
    complexed with bma, man, nag

Details for d5o4gc1

PDB Entry: 5o4g (more details), 3 Å

PDB Description: her2 in complex with fab mf3958
PDB Compounds: (C:) Receptor tyrosine-protein kinase erbB-2

SCOPe Domain Sequences for d5o4gc1:

Sequence, based on SEQRES records: (download)

>d5o4gc1 c.10.2.0 (C:1-165) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tqvctgtdmklrlpaspethldmlrhlyqgcqvvqgnleltylptnaslsflqdiqevqg
yvliahnqvrqvplqrlrivrgtqlfednyalavldngdplnnttpvtgaspgglrelql
rslteilkggvliqrnpqlcyqdtilwkdifhknnqlaltlidtn

Sequence, based on observed residues (ATOM records): (download)

>d5o4gc1 c.10.2.0 (C:1-165) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tqvctgtdmklrlpaspethldmlrhlyqgcqvvqgnleltylptnaslsflqdiqevqg
yvliahnqvrqvplqrlrivrgtqlfednyalavldngdpgglrelqlrslteilkggvl
iqrnpqlcyqdtilwkdifhknnqlaltlidtn

SCOPe Domain Coordinates for d5o4gc1:

Click to download the PDB-style file with coordinates for d5o4gc1.
(The format of our PDB-style files is described here.)

Timeline for d5o4gc1:

  • d5o4gc1 appears in periodic updates to SCOPe 2.07 starting on 2018-05-17