Lineage for d5o3qc1 (5o3q C:2-110)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2516578Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2517841Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 2518136Family d.58.5.0: automated matches [191474] (1 protein)
    not a true family
  6. 2518137Protein automated matches [190753] (18 species)
    not a true protein
  7. 3052100Species Synechocystis sp. [TaxId:1111708] [352162] (2 PDB entries)
  8. 3052176Domain d5o3qc1: 5o3q C:2-110 [352238]
    Other proteins in same PDB: d5o3qa2, d5o3qb2, d5o3qc2
    automated match to d3dfeb_
    complexed with bct, cmp

Details for d5o3qc1

PDB Entry: 5o3q (more details), 1.75 Å

PDB Description: carbon regulatory pii-like protein sbtb from synechocystis sp. 6803 in complex with cyclic amp (camp)
PDB Compounds: (C:) Membrane-associated protein slr1513

SCOPe Domain Sequences for d5o3qc1:

Sequence, based on SEQRES records: (download)

>d5o3qc1 d.58.5.0 (C:2-110) automated matches {Synechocystis sp. [TaxId: 1111708]}
akpanklvivtekillkkiakiidesgakgytvmntggkgsrnvrssgqpntsdieanik
feiltetremaeeiadrvavkyfndyagiiyicsaevlyghtfcgpegc

Sequence, based on observed residues (ATOM records): (download)

>d5o3qc1 d.58.5.0 (C:2-110) automated matches {Synechocystis sp. [TaxId: 1111708]}
akpanklvivtekillkkiakiidesgakgytvmntggkgieanikfeiltetremaeei
adrvavkyfndyagiiyicsaevlyghtfcgpegc

SCOPe Domain Coordinates for d5o3qc1:

Click to download the PDB-style file with coordinates for d5o3qc1.
(The format of our PDB-style files is described here.)

Timeline for d5o3qc1:

  • d5o3qc1 appears in periodic updates to SCOPe 2.07 starting on 2018-05-17