Lineage for d5nkta_ (5nkt A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2363595Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2363797Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 2364168Family b.2.3.0: automated matches [191391] (1 protein)
    not a true family
  6. 2364169Protein automated matches [190503] (9 species)
    not a true protein
  7. 2364195Species Escherichia coli [TaxId:83333] [346217] (3 PDB entries)
  8. 3052172Domain d5nkta_: 5nkt A: [352234]
    automated match to d2m5ga_
    complexed with so4

Details for d5nkta_

PDB Entry: 5nkt (more details), 1.5 Å

PDB Description: fima wt from e. coli
PDB Compounds: (A:) Type-1 fimbrial protein, A chain

SCOPe Domain Sequences for d5nkta_:

Sequence, based on SEQRES records: (download)

>d5nkta_ b.2.3.0 (A:) automated matches {Escherichia coli [TaxId: 83333]}
ggtvhfkgevvnaacavdagsvdqtvqlgqvrtaslaqegatssavgfniqlndcdtnva
skaavaflgtaidaghtnvlalqssaagsatnvgvqildrtgaaltldgatfssettlnn
gtntipfqaryfatgaatpgaanadatfkvqyq

Sequence, based on observed residues (ATOM records): (download)

>d5nkta_ b.2.3.0 (A:) automated matches {Escherichia coli [TaxId: 83333]}
ggtvhfkgevvnaacavdagsvdqtvqlgqvrtaslaqegatssavgfniqlndcdtnva
skaavaflgtaidaghtnvlalqssgsatnvgvqildrtgaaltldgatfssettlnngt
ntipfqaryfatgaatpgaanadatfkvqyq

SCOPe Domain Coordinates for d5nkta_:

Click to download the PDB-style file with coordinates for d5nkta_.
(The format of our PDB-style files is described here.)

Timeline for d5nkta_:

  • d5nkta_ appears in periodic updates to SCOPe 2.07 starting on 2018-05-17