Lineage for d6f8ra_ (6f8r A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2342123Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2342124Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 2342214Family a.211.1.2: PDEase [48548] (7 protein domains)
    Pfam PF00233; multihelical; can be divided into three subdomains
  6. 2342501Protein automated matches [190370] (1 species)
    not a true protein
  7. 2342502Species Human (Homo sapiens) [TaxId:9606] [187208] (34 PDB entries)
  8. 3052170Domain d6f8ra_: 6f8r A: [352232]
    Other proteins in same PDB: d6f8rb2
    automated match to d1rora_
    complexed with czk, edo, mg, zn

Details for d6f8ra_

PDB Entry: 6f8r (more details), 1.83 Å

PDB Description: crystal structure of the pde4d catalytic domain in complex with gebr- 54
PDB Compounds: (A:) cAMP-specific 3',5'-cyclic phosphodiesterase 4D

SCOPe Domain Sequences for d6f8ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6f8ra_ a.211.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlitylmtl
edhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhpgvsn
qflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvidivl
atdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnptkplqly
rqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwadlvh
pdaqdildtlednrewyqstip

SCOPe Domain Coordinates for d6f8ra_:

Click to download the PDB-style file with coordinates for d6f8ra_.
(The format of our PDB-style files is described here.)

Timeline for d6f8ra_:

  • d6f8ra_ appears in periodic updates to SCOPe 2.07 starting on 2018-05-17