Lineage for d5nr2a_ (5nr2 A:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2575768Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
  4. 2575889Superfamily f.4.3: Porins [56935] (5 families) (S)
  5. 2576049Family f.4.3.3: Ligand-gated protein channel [56948] (5 protein domains)
    monomeric (22,24) barrel; ~150 N-terminal residues form a "plug" or "cork" subdomain
  6. 2576088Protein automated matches [238352] (2 species)
    not a true protein
  7. 3046501Species Pseudomonas aeruginosa [TaxId:208964] [346563] (5 PDB entries)
  8. 3052166Domain d5nr2a_: 5nr2 A: [352228]
    automated match to d1fepa_
    complexed with 95b, edo, fe

Details for d5nr2a_

PDB Entry: 5nr2 (more details), 2.78 Å

PDB Description: crystal structure of the ferric enterobactin receptor (pfea) from pseudomonas aeruginosa in complex with azotochelin
PDB Compounds: (A:) ferric enterobactin receptor

SCOPe Domain Sequences for d5nr2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nr2a_ f.4.3.3 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
kqapgvsiitaediakrppsndlsqiirtmpgvnltgnsssgqrgnnrqidirgmgpent
lilvdgkpvssrnsvrygwrgerdsrgdtnwvpadqverievirgpaaarygngaaggvv
niitkqagaethgnlsvysnfpqhkaegasermsfglngpltenlsyrvygniaktdsdd
wdinaghesnrtgkqagtlpagregvrnkdidgllswrltpeqtlefeagfsrqgniytg
dtqntnsnnyvkqmlghetnrmyretysvthrgewdfgsslaylqyektrnsrineglag
gtegifdpnnagfytatlrdltahgevnlplhlgyeqtltlgsewteqklddpssntqnt
eeggsipglagknrsssssarifslfaednielmpgtmltpglrwdhhdivgdnwspsln
lshaltervtlkagiaraykapnlyqlnpdyllysrgqgcygqstscylrgndglkaets
vnkelgieyshdglvagltyfrndyknkiesglspvdhasggkgdyanaaiyqwenvpka
vveglegtltlpladglkwsnnltymlqsknketgdvlsvtprytlnsmldwqatddlsl
qatvtwygkqkpkkydyhgdrvtgsandqlspyaiaglggtyrlsknlslgagvdnlfdk
rlfragnaqgvvgidgagaatynepgrtfytsltasf

SCOPe Domain Coordinates for d5nr2a_:

Click to download the PDB-style file with coordinates for d5nr2a_.
(The format of our PDB-style files is described here.)

Timeline for d5nr2a_:

  • d5nr2a_ appears in periodic updates to SCOPe 2.07 starting on 2018-05-17