Lineage for d5o3pb1 (5o3p B:2-110)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2950563Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 2950865Family d.58.5.0: automated matches [191474] (1 protein)
    not a true family
  6. 2950866Protein automated matches [190753] (21 species)
    not a true protein
  7. 2951052Species Synechocystis sp. [TaxId:1148] [352158] (3 PDB entries)
  8. 2951056Domain d5o3pb1: 5o3p B:2-110 [352221]
    Other proteins in same PDB: d5o3pa2, d5o3pb2, d5o3pc2
    automated match to d3dfeb_
    complexed with 1pe, peg

Details for d5o3pb1

PDB Entry: 5o3p (more details), 1.75 Å

PDB Description: carbon regulatory pii-like protein sbtb from synechocystis sp. 6803 in apo state, trigonal crystal form
PDB Compounds: (B:) Membrane-associated protein slr1513

SCOPe Domain Sequences for d5o3pb1:

Sequence, based on SEQRES records: (download)

>d5o3pb1 d.58.5.0 (B:2-110) automated matches {Synechocystis sp. [TaxId: 1148]}
akpanklvivtekillkkiakiidesgakgytvmntggkgsrnvrssgqpntsdieanik
feiltetremaeeiadrvavkyfndyagiiyicsaevlyghtfcgpegc

Sequence, based on observed residues (ATOM records): (download)

>d5o3pb1 d.58.5.0 (B:2-110) automated matches {Synechocystis sp. [TaxId: 1148]}
akpanklvivtekillkkiakiidesgakgytvmntggkgsdieanikfeiltetremae
eiadrvavkyfndyagiiyicsaevlyghtfcgpegc

SCOPe Domain Coordinates for d5o3pb1:

Click to download the PDB-style file with coordinates for d5o3pb1.
(The format of our PDB-style files is described here.)

Timeline for d5o3pb1: