SCOPe 2.08: Domain d5tx9b2: 5tx9 B:316-383

Lineage for d5tx9b2 (5tx9 B:316-383)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.105: Penicillin-binding protein associated domain [69188] (1 superfamily)
   sandwich; 6 strands in 2 sheets

4. Superfamily b.105.1: Penicillin-binding protein associated domain [69189] (3 families)

5. Family b.105.1.0: automated matches [231757] (1 protein)
   not a true family

6. Protein automated matches [231758] (5 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:93062] [352204] (11 PDB entries)

8. Domain d5tx9b2: 5tx9 B:316-383 [352217]
   Other proteins in same PDB: d5tx9a1, d5tx9b1
   automated match to d3huma2
   complexed with na, rb6, zn; mutant

Details for d5tx9b2

PDB Entry: 5tx9, 1.68 Å

PDB Description: crystal structure of s. aureus penicillin binding protein 4 (pbp4) mutant (e183a, f241r) in complex with ceftobiprole

PDB Compounds: (B:) Penicillin-binding protein 4

SCOPe Domain Sequences for d5tx9b2:

Sequence; same for both SEQRES and ATOM records:

>d5tx9b2 b.105.1.0 (B:316-383) automated matches {Staphylococcus aureus [TaxId: 93062]}
kyvkilskgeqringkkyyvendlydvlpsdfskkdyklvvedgkvhadyprefinkdyg
pptvevhq

Timeline for d5tx9b2:

• d5tx9b2 first appeared in SCOPe 2.07