Lineage for d5np3d1 (5np3 D:64-120)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2376890Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2377019Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2377486Family b.34.2.0: automated matches [191375] (1 protein)
    not a true family
  6. 2377487Protein automated matches [190457] (10 species)
    not a true protein
  7. 2377559Species Human (Homo sapiens) [TaxId:9606] [187598] (93 PDB entries)
  8. 3052141Domain d5np3d1: 5np3 D:64-120 [352203]
    Other proteins in same PDB: d5np3b2, d5np3d2
    automated match to d1fyna_

Details for d5np3d1

PDB Entry: 5np3 (more details), 2 Å

PDB Description: abl2 sh3
PDB Compounds: (D:) Abelson tyrosine-protein kinase 2

SCOPe Domain Sequences for d5np3d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5np3d1 b.34.2.0 (D:64-120) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nlfvalydfvasgdntlsitkgeklrvlgynqngewsevrskngqgwvpsnyitpvn

SCOPe Domain Coordinates for d5np3d1:

Click to download the PDB-style file with coordinates for d5np3d1.
(The format of our PDB-style files is described here.)

Timeline for d5np3d1:

  • d5np3d1 appears in periodic updates to SCOPe 2.07 starting on 2018-05-17