Lineage for d5nhsb2 (5nhs B:138-295)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2426096Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2426097Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2430344Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2430345Protein automated matches [190069] (247 species)
    not a true protein
  7. 3052135Species Xanthomonas albilineans [TaxId:380358] [352197] (1 PDB entry)
  8. 3052136Domain d5nhsb2: 5nhs B:138-295 [352198]
    Other proteins in same PDB: d5nhsa1, d5nhsb1
    automated match to d6apea2
    complexed with edo

Details for d5nhsb2

PDB Entry: 5nhs (more details), 2.11 Å

PDB Description: the crystal structure of xanthomonas albilineans n5, n10- methylenetetrahydrofolate dehydrogenase-cyclohydrolase (fold)
PDB Compounds: (B:) Bifunctional protein folD

SCOPe Domain Sequences for d5nhsb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nhsb2 c.2.1.0 (B:138-295) automated matches {Xanthomonas albilineans [TaxId: 380358]}
ghlalrefglrpctprgivtllahtdqpvrgrnativgvsnhvgrpmalelliagctvsc
chkftpadvlqthvrdadilvvavgrpglipgdwvkpgavvidvginrlddgrlvgdvgf
eaaaqraswitpvpggvgpmtvatlmqntieaadaalr

SCOPe Domain Coordinates for d5nhsb2:

Click to download the PDB-style file with coordinates for d5nhsb2.
(The format of our PDB-style files is described here.)

Timeline for d5nhsb2:

  • d5nhsb2 appears in periodic updates to SCOPe 2.07 starting on 2018-05-17

View in 3D
Domains from same chain:
(mouse over for more information)
d5nhsb1