Lineage for d5nhsb1 (5nhs B:10-131)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2466799Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 2466800Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 2467113Family c.58.1.0: automated matches [227157] (1 protein)
    not a true family
  6. 2467114Protein automated matches [226864] (32 species)
    not a true protein
  7. 3052133Species Xanthomonas albilineans [TaxId:380358] [352195] (1 PDB entry)
  8. 3052134Domain d5nhsb1: 5nhs B:10-131 [352196]
    Other proteins in same PDB: d5nhsa2, d5nhsb2
    automated match to d6apea1
    complexed with edo

Details for d5nhsb1

PDB Entry: 5nhs (more details), 2.11 Å

PDB Description: the crystal structure of xanthomonas albilineans n5, n10- methylenetetrahydrofolate dehydrogenase-cyclohydrolase (fold)
PDB Compounds: (B:) Bifunctional protein folD

SCOPe Domain Sequences for d5nhsb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nhsb1 c.58.1.0 (B:10-131) automated matches {Xanthomonas albilineans [TaxId: 380358]}
vparildgrriaedlldelktrvdarlaagqprpglavvlvggdpastvyvrnkrraaek
vgieafdydlpagtgeaellslidqlnadpkihgilvqlplpgiadasrlihridprkdv
dg

SCOPe Domain Coordinates for d5nhsb1:

Click to download the PDB-style file with coordinates for d5nhsb1.
(The format of our PDB-style files is described here.)

Timeline for d5nhsb1:

  • d5nhsb1 appears in periodic updates to SCOPe 2.07 starting on 2018-05-17

View in 3D
Domains from same chain:
(mouse over for more information)
d5nhsb2