SCOPe 2.08: Domain d5o4ga2: 5o4g A:107-214

Lineage for d5o4ga2 (5o4g A:107-214)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d5o4ga2: 5o4g A:107-214 [352190]
   Other proteins in same PDB: d5o4ga1, d5o4gc1, d5o4gc2, d5o4gc3
   automated match to d1dn0a2
   complexed with nag

Details for d5o4ga2

PDB Entry: 5o4g, 3 Å

PDB Description: her2 in complex with fab mf3958

PDB Compounds: (A:) MF3958 FAB light chain

SCOPe Domain Sequences for d5o4ga2:

Sequence; same for both SEQRES and ATOM records:

>d5o4ga2 b.1.1.2 (A:107-214) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

Timeline for d5o4ga2:

• d5o4ga2 first appeared in SCOPe 2.07