Class a: All alpha proteins [46456] (289 folds) |
Fold a.246: Hyaluronidase domain-like [140656] (3 superfamilies) 5 helices; bundle, closed, left-handed twist; up-and-down (meander) topology |
Superfamily a.246.1: Hyaluronidase post-catalytic domain-like [140657] (2 families) |
Family a.246.1.0: automated matches [254242] (1 protein) not a true family |
Protein automated matches [254554] (3 species) not a true protein |
Species Clostridium perfringens [TaxId:1502] [255691] (3 PDB entries) |
Domain d5oxda3: 5oxd A:496-618 [352188] Other proteins in same PDB: d5oxda1, d5oxda2 automated match to d2v5ca3 complexed with b2w, cd |
PDB Entry: 5oxd (more details), 2.6 Å
SCOPe Domain Sequences for d5oxda3:
Sequence; same for both SEQRES and ATOM records: (download)
>d5oxda3 a.246.1.0 (A:496-618) automated matches {Clostridium perfringens [TaxId: 1502]} edapelrakmdelwnklsskedasalieelygefarmeeacnnlkanlpevaleecsrql delitlaqgdkasldmivaqlnedteayesakeiaqnklntalssfavisekvaqsfiqe als
Timeline for d5oxda3: