Lineage for d5oxda3 (5oxd A:496-618)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2351179Fold a.246: Hyaluronidase domain-like [140656] (3 superfamilies)
    5 helices; bundle, closed, left-handed twist; up-and-down (meander) topology
  4. 2351180Superfamily a.246.1: Hyaluronidase post-catalytic domain-like [140657] (2 families) (S)
  5. 2351212Family a.246.1.0: automated matches [254242] (1 protein)
    not a true family
  6. 2351213Protein automated matches [254554] (3 species)
    not a true protein
  7. 2351220Species Clostridium perfringens [TaxId:1502] [255691] (3 PDB entries)
  8. 2351229Domain d5oxda3: 5oxd A:496-618 [352188]
    Other proteins in same PDB: d5oxda1, d5oxda2
    automated match to d2v5ca3
    complexed with b2w, cd

Details for d5oxda3

PDB Entry: 5oxd (more details), 2.6 Å

PDB Description: complex of a c. perfringens o-glcnacase with a fragment hit
PDB Compounds: (A:) O-GlcNAcase nagJ

SCOPe Domain Sequences for d5oxda3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5oxda3 a.246.1.0 (A:496-618) automated matches {Clostridium perfringens [TaxId: 1502]}
edapelrakmdelwnklsskedasalieelygefarmeeacnnlkanlpevaleecsrql
delitlaqgdkasldmivaqlnedteayesakeiaqnklntalssfavisekvaqsfiqe
als

SCOPe Domain Coordinates for d5oxda3:

Click to download the PDB-style file with coordinates for d5oxda3.
(The format of our PDB-style files is described here.)

Timeline for d5oxda3: