Lineage for d5ok4a2 (5ok4 A:245-344)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2329494Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2329495Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2329704Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 2329705Protein automated matches [226851] (37 species)
    not a true protein
  7. 2329916Species Methanothermobacter marburgensis [TaxId:79929] [235008] (3 PDB entries)
  8. 3052123Domain d5ok4a2: 5ok4 A:245-344 [352185]
    Other proteins in same PDB: d5ok4a1
    automated match to d4jjfa2
    complexed with fe, feg, gol

Details for d5ok4a2

PDB Entry: 5ok4 (more details), 1.29 Å

PDB Description: crystal structure of native [fe]-hydrogenase hmd from methanothermobacter marburgensis inactivated by o2.
PDB Compounds: (A:) 5,10-methenyltetrahydromethanopterin hydrogenase

SCOPe Domain Sequences for d5ok4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ok4a2 a.100.1.0 (A:245-344) automated matches {Methanothermobacter marburgensis [TaxId: 79929]}
aellgpvcdmcsaltaityagilsyrdsvtqvlgapasfaqmmakesleqitalmekvgi
dkmeenldpgallgtadsmnfgasaeilptvfeilekrkk

SCOPe Domain Coordinates for d5ok4a2:

Click to download the PDB-style file with coordinates for d5ok4a2.
(The format of our PDB-style files is described here.)

Timeline for d5ok4a2:

  • d5ok4a2 appears in periodic updates to SCOPe 2.07 starting on 2018-05-17

View in 3D
Domains from same chain:
(mouse over for more information)
d5ok4a1