Lineage for d5nhkb_ (5nhk B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304501Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2305606Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2307165Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2307166Protein automated matches [190154] (73 species)
    not a true protein
  7. 3052064Species Francisella tularensis [TaxId:263] [352126] (2 PDB entries)
  8. 3052118Domain d5nhkb_: 5nhk B: [352180]
    automated match to d2fe3a_
    complexed with fe, zn

Details for d5nhkb_

PDB Entry: 5nhk (more details), 1.8 Å

PDB Description: structure of ferric uptake regulator from francisella tularensis with iron
PDB Compounds: (B:) ferric uptake regulation protein

SCOPe Domain Sequences for d5nhkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nhkb_ a.4.5.0 (B:) automated matches {Francisella tularensis [TaxId: 263]}
dlkefgfkvtqprveilklfeknkdkhlspddvfsklkaqgsttgiatvyrvlnqfesag
iinrlkldneqvmyelnqgehhdhiicvkcnmiqefyspgiealqkqivesfgaemidys
lniyvkckscre

SCOPe Domain Coordinates for d5nhkb_:

Click to download the PDB-style file with coordinates for d5nhkb_.
(The format of our PDB-style files is described here.)

Timeline for d5nhkb_:

  • d5nhkb_ appears in periodic updates to SCOPe 2.07 starting on 2018-05-17