Lineage for d5nhxa_ (5nhx A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2525085Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2526336Superfamily d.79.7: OmpA-like [103088] (2 families) (S)
  5. 2526362Family d.79.7.0: automated matches [195454] (1 protein)
    not a true family
  6. 2526363Protein automated matches [195455] (13 species)
    not a true protein
  7. 3052086Species Klebsiella pneumoniae [TaxId:573] [352148] (1 PDB entry)
  8. 3052087Domain d5nhxa_: 5nhx A: [352149]
    automated match to d4rhaa_
    complexed with cit

Details for d5nhxa_

PDB Entry: 5nhx (more details), 1.95 Å

PDB Description: periplasmic domain of outer membrane protein a from klebsiella pneumoniae
PDB Compounds: (A:) outer membrane protein a

SCOPe Domain Sequences for d5nhxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nhxa_ d.79.7.0 (A:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
atkhftlksdvlfnfnkatlkpegqqaldqlytqlsnmdpkdgsavvlgytdrigseayn
qqlsekraqsvvdylvakgipagkisargmgesnpvtgntcdnvkaraalidclapdrrv
eievkg

SCOPe Domain Coordinates for d5nhxa_:

Click to download the PDB-style file with coordinates for d5nhxa_.
(The format of our PDB-style files is described here.)

Timeline for d5nhxa_:

  • d5nhxa_ appears in periodic updates to SCOPe 2.07 starting on 2018-05-17