Lineage for d5nl7a1 (5nl7 A:2-122)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2321178Fold a.40: CH domain-like [47575] (3 superfamilies)
    core: 4 helices: bundle
  4. 2321179Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families) (S)
  5. 2321257Family a.40.1.0: automated matches [227151] (1 protein)
    not a true family
  6. 2321258Protein automated matches [226856] (4 species)
    not a true protein
  7. 3052081Species Entamoeba histolytica [TaxId:5759] [352143] (1 PDB entry)
  8. 3052082Domain d5nl7a1: 5nl7 A:2-122 [352144]
    automated match to d5bvra1
    complexed with ca, trs

Details for d5nl7a1

PDB Entry: 5nl7 (more details), 2.48 Å

PDB Description: the crystal structure of the actin binding domain (abd) of alpha actinin from entamoeba histolytica
PDB Compounds: (A:) Calponin homology domain protein putative

SCOPe Domain Sequences for d5nl7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nl7a1 a.40.1.0 (A:2-122) automated matches {Entamoeba histolytica [TaxId: 5759]}
adselvaqwekvqiktftkwvnmhlakkgrkindvttdfkngvelcalleiigettikcv
tnpkmriqmtenldkalrfiqsrdvkltgigptdivdgnvkltlglvwtlilrfaisels
a

SCOPe Domain Coordinates for d5nl7a1:

Click to download the PDB-style file with coordinates for d5nl7a1.
(The format of our PDB-style files is described here.)

Timeline for d5nl7a1:

  • d5nl7a1 appears in periodic updates to SCOPe 2.07 starting on 2018-05-17

View in 3D
Domains from same chain:
(mouse over for more information)
d5nl7a2