Lineage for d5ngxa_ (5ngx A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2311272Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2311322Superfamily a.24.3: Cytochromes [47175] (3 families) (S)
    Heme-containing proteins
  5. 2311490Family a.24.3.2: Cytochrome c'-like [47179] (3 protein domains)
    automatically mapped to Pfam PF01322
  6. 2311544Protein automated matches [190363] (5 species)
    not a true protein
  7. 2311574Species Alcaligenes xylosoxydans [TaxId:85698] [330675] (8 PDB entries)
  8. 3052080Domain d5ngxa_: 5ngx A: [352142]
    automated match to d2yl3a_
    complexed with gol, hec, no2; mutant

Details for d5ngxa_

PDB Entry: 5ngx (more details), 1.06 Å

PDB Description: the 1.06 a resolution structure of the l16g mutant of ferric cytochrome c prime from alcaligenes xylosoxidans, complexed with nitrite
PDB Compounds: (A:) cytochrome c'

SCOPe Domain Sequences for d5ngxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ngxa_ a.24.3.2 (A:) automated matches {Alcaligenes xylosoxydans [TaxId: 85698]}
efakpedavkyrqsagtlmashfgrmtpvvkgqapydaaqikanvevlktlsalpwaafg
pgteggdarpeiwsdaasfkqkqqafqdnivklsaaadagdldklraafgdvgasckach
dayrkk

SCOPe Domain Coordinates for d5ngxa_:

Click to download the PDB-style file with coordinates for d5ngxa_.
(The format of our PDB-style files is described here.)

Timeline for d5ngxa_:

  • d5ngxa_ appears in periodic updates to SCOPe 2.07 starting on 2018-05-17