Lineage for d5nfsa_ (5nfs A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2387558Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2387559Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2389935Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)
  6. 2390138Protein automated matches [190384] (20 species)
    not a true protein
  7. 2390139Species Coxsackievirus b3 [TaxId:103903] [188647] (2 PDB entries)
  8. 3052075Domain d5nfsa_: 5nfs A: [352137]
    automated match to d2vb0a_
    complexed with d03

Details for d5nfsa_

PDB Entry: 5nfs (more details), 1.8 Å

PDB Description: structure of coxsackievirus b3 3c protease in complex with the alpha- ketoamide (s)-n-benzyl-3-((s)-2-cinnamamido-3-phenylpropanamido)-2- oxo-4-((s)-2-oxopyrrolidin-3-yl)butanamide (cinnamoyl-phenylalanine- glnlactam-co-co-nh-benzyl)
PDB Compounds: (A:) Genome polyprotein

SCOPe Domain Sequences for d5nfsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nfsa_ b.47.1.4 (A:) automated matches {Coxsackievirus b3 [TaxId: 103903]}
gpafefavammkrnsstvkteygeftmlgiydrwavlprhakpgptilmndqevgvldak
elvdkdgtnleltllklnrnekfrdirgflakeevevneavlaintskfpnmyipvgqvt
eygflnlggtptkrmlmynfptragqcggvlmstgkvlgihvggnghqgfsaallkhyfn

SCOPe Domain Coordinates for d5nfsa_:

Click to download the PDB-style file with coordinates for d5nfsa_.
(The format of our PDB-style files is described here.)

Timeline for d5nfsa_:

  • d5nfsa_ appears in periodic updates to SCOPe 2.07 starting on 2018-05-17