Lineage for d5ncma_ (5ncm A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2708838Superfamily a.29.7: Mob1/phocein [101152] (2 families) (S)
    common fold is elaborated with additional short helices; contains a zinc-binding site
    automatically mapped to Pfam PF03637
  5. 2708866Family a.29.7.0: automated matches [352133] (1 protein)
    not a true family
  6. 2708867Protein automated matches [352134] (1 species)
    not a true protein
  7. 2708868Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [352135] (2 PDB entries)
  8. 2708869Domain d5ncma_: 5ncm A: [352136]
    automated match to d1pi1a_
    complexed with zn

Details for d5ncma_

PDB Entry: 5ncm (more details), 2.8 Å

PDB Description: crystal structure cbk1(ntr)-mob2 complex
PDB Compounds: (A:) CBK1 kinase activator protein MOB2

SCOPe Domain Sequences for d5ncma_:

Sequence, based on SEQRES records: (download)

>d5ncma_ a.29.7.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
qimflsepfvrtalvkgsfktivqlpkyvdlgewialnvfefftnlnqfygvvaeyctpd
acptmnagphtdylwldannrqvslpasqyidlaltwinnkvndknlfptknglpfpqqf
srdvqrimvqmfrifahiyhhhfdkivhlsleahwnsffshfisfakefkiidrkemapl
lpliesfekqgki

Sequence, based on observed residues (ATOM records): (download)

>d5ncma_ a.29.7.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
qimflsepfvrtalvkgsfktivqlpkyvdlgewialnvfefftnlnqfygvvaeyctpd
nagphtdylwldanlpasqyidlaltwinnkvndknlfptknglpfpqqfsrdvqrimvq
mfrifahiyhhhfdkivhlsleahwnsffshfisfakefkiidrkemapllpliesfekq
gki

SCOPe Domain Coordinates for d5ncma_:

Click to download the PDB-style file with coordinates for d5ncma_.
(The format of our PDB-style files is described here.)

Timeline for d5ncma_: