Class a: All alpha proteins [46456] (290 folds) |
Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily) multihelical; consists of two different alpha-helical bundles |
Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) |
Family a.211.1.2: PDEase [48548] (7 proteins) Pfam PF00233; multihelical; can be divided into three subdomains |
Protein Catalytic domain of cyclic nucleotide phosphodiesterase pde4d [89151] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [89152] (89 PDB entries) Uniprot Q08499 388-713 |
Domain d6f6ub1: 6f6u B:256-578 [352112] Other proteins in same PDB: d6f6ub2 automated match to d1rora_ complexed with cv8, gol, mg, zn |
PDB Entry: 6f6u (more details), 1.83 Å
SCOPe Domain Sequences for d6f6ub1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6f6ub1 a.211.1.2 (B:256-578) Catalytic domain of cyclic nucleotide phosphodiesterase pde4d {Human (Homo sapiens) [TaxId: 9606]} dvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlitylmtl edhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhpgvsn qflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvidivl atdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnptkplqly rqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwadlvh pdaqdildtlednrewyqstipq
Timeline for d6f6ub1: