Lineage for d6fm2b_ (6fm2 B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2402886Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2403118Superfamily b.80.5: C-terminal domain of adenylylcyclase associated protein [69340] (2 families) (S)
    superhelix turns are made of two strands each
    automatically mapped to Pfam PF08603
  5. 2403119Family b.80.5.1: C-terminal domain of adenylylcyclase associated protein [69341] (2 protein domains)
  6. 3052045Protein automated matches [352107] (1 species)
    not a true protein
  7. 3052046Species Mus musculus [TaxId:10090] [352108] (1 PDB entry)
  8. 3052047Domain d6fm2b_: 6fm2 B: [352109]
    Other proteins in same PDB: d6fm2a1, d6fm2a2
    automated match to d1k8fa_
    complexed with adp, hic, mg

Details for d6fm2b_

PDB Entry: 6fm2 (more details), 2.8 Å

PDB Description: carp domain of mouse cyclase-associated protein 1 (cap1) bound to adp- actin
PDB Compounds: (B:) Adenylyl cyclase-associated protein 1

SCOPe Domain Sequences for d6fm2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fm2b_ b.80.5.1 (B:) automated matches {Mus musculus [TaxId: 10090]}
epallelegkkwrvenqenvsnlviddtelkqvayiykcvnttlqikgkinsitvdnckk
lglvfddvvgiveiinsrdvkvqvmgkvptisinktdgchaylsknsldceivsakssem
nvlipteggdfnefpvpeqfktlwngqklvttvteia

SCOPe Domain Coordinates for d6fm2b_:

Click to download the PDB-style file with coordinates for d6fm2b_.
(The format of our PDB-style files is described here.)

Timeline for d6fm2b_:

  • d6fm2b_ appears in periodic updates to SCOPe 2.07 starting on 2018-05-17