Lineage for d6enmb_ (6enm B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2528985Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2528986Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2529558Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 protein domains)
  6. 2529736Protein Macrophage elastase (MMP-12) [69780] (1 species)
  7. 2529737Species Human (Homo sapiens) [TaxId:9606] [69781] (56 PDB entries)
    Uniprot P39900 106-263 ! Uniprot P39900 106-264
  8. 3052036Domain d6enmb_: 6enm B: [352098]
    automated match to d5i43b_
    complexed with ca, lpw, zn

Details for d6enmb_

PDB Entry: 6enm (more details), 1.59 Å

PDB Description: crystal structure of mmp12 in complex with hydroxamate inhibitor lp168.
PDB Compounds: (B:) Macrophage metalloelastase

SCOPe Domain Sequences for d6enmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6enmb_ d.92.1.11 (B:) Macrophage elastase (MMP-12) {Human (Homo sapiens) [TaxId: 9606]}
hyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfargahgdd
hafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslglghssd
pkavmfptykyvdintfrlsaddirgiqslyg

SCOPe Domain Coordinates for d6enmb_:

Click to download the PDB-style file with coordinates for d6enmb_.
(The format of our PDB-style files is described here.)

Timeline for d6enmb_:

  • d6enmb_ appears in periodic updates to SCOPe 2.07 starting on 2018-05-17