Lineage for d6d38a_ (6d38 A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2508387Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2508388Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2509060Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 2509061Protein automated matches [190526] (21 species)
    not a true protein
  7. 2509172Species Echinophyllia sp. [TaxId:301887] [188534] (18 PDB entries)
  8. 3052033Domain d6d38a_: 6d38 A: [352095]
    automated match to d1xssb_
    complexed with so4

Details for d6d38a_

PDB Entry: 6d38 (more details), 2.8 Å

PDB Description: photodissociable dimeric dronpa green fluorescent protein variant m (pddronpam)
PDB Compounds: (A:) Fluorescent protein Dronpa

SCOPe Domain Sequences for d6d38a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6d38a_ d.22.1.0 (A:) automated matches {Echinophyllia sp. [TaxId: 301887]}
vikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvfc
ygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfrg
tnfpangpvmqkrtvkwepstenlyvrdgvlkgdvmmalsleggghyrcdfkttykakkv
vqlpdyhfvdhhieikshdkdysnvnlhehaeahs

SCOPe Domain Coordinates for d6d38a_:

Click to download the PDB-style file with coordinates for d6d38a_.
(The format of our PDB-style files is described here.)

Timeline for d6d38a_:

  • d6d38a_ appears in periodic updates to SCOPe 2.07 starting on 2018-05-17