Lineage for d6c1pa_ (6c1p A:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2577060Fold f.14: Gated ion channels [81325] (2 superfamilies)
    oligomeric transmembrane alpha-helical proteins
  4. 2577061Superfamily f.14.1: Voltage-gated ion channels [81324] (3 families) (S)
    Pfam PF00520
  5. 2577188Family f.14.1.2: Voltage-gated Na/Ca cation channels [310631] (4 protein domains)
    Pfam PF08016
  6. 2577201Protein NavAb sodium channel [310744] (1 species)
  7. 2577202Species Arcobacter butzleri [TaxId:367737] [310997] (7 PDB entries)
  8. 3052023Domain d6c1pa_: 6c1p A: [352085]
    automated match to d3rvya_
    complexed with 1n7, po4, px4; mutant

Details for d6c1pa_

PDB Entry: 6c1p (more details), 2.9 Å

PDB Description: hypopp mutant
PDB Compounds: (A:) Ion transport protein

SCOPe Domain Sequences for d6c1pa_:

Sequence, based on SEQRES records: (download)

>d6c1pa_ f.14.1.2 (A:) NavAb sodium channel {Arcobacter butzleri [TaxId: 367737]}
mylritnivessfftkfiiylivlngitmgletsktfmqsfgvyttlfnqivitiftiei
ilriyvhrisffkdpwslfdffvvaislvptssgfeilrvlgvlrlfrlvtavpqmrkiv
salisvipgmlsvialmtlffyifaimatqlfgerfpewfgtlgesfytlfqvmtlesws
mgivrplmevypyawvffipfifvvtfvminlvvaicvda

Sequence, based on observed residues (ATOM records): (download)

>d6c1pa_ f.14.1.2 (A:) NavAb sodium channel {Arcobacter butzleri [TaxId: 367737]}
mylritnivessfftkfiiylivlngitmgletsktfmqsfgvyttlfnqivitiftiei
ilriyvhrisffkdpwslfdffvvaislvptsfeilrvlgvlrlfrlvtavpqmrkivsa
lisvipgmlsvialmtlffyifaimatqlfgerfpewfgtlgesfytlfqvmtleswsmg
ivrplmevypyawvffipfifvvtfvminlvvaicvda

SCOPe Domain Coordinates for d6c1pa_:

Click to download the PDB-style file with coordinates for d6c1pa_.
(The format of our PDB-style files is described here.)

Timeline for d6c1pa_:

  • d6c1pa_ appears in periodic updates to SCOPe 2.07 starting on 2018-05-17