Lineage for d6ekna1 (6ekn A:106-263)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2528985Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2528986Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2529558Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 2529736Protein Macrophage elastase (MMP-12) [69780] (1 species)
  7. 2529737Species Human (Homo sapiens) [TaxId:9606] [69781] (56 PDB entries)
    Uniprot P39900 106-263 ! Uniprot P39900 106-264
  8. 3052019Domain d6ekna1: 6ekn A:106-263 [352081]
    Other proteins in same PDB: d6ekna2
    automated match to d5i43b_
    complexed with b9n, ca, edo, zn

Details for d6ekna1

PDB Entry: 6ekn (more details), 1.2 Å

PDB Description: crystal structure of mmp12 in complex with inhibitor be7.
PDB Compounds: (A:) Macrophage metalloelastase

SCOPe Domain Sequences for d6ekna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ekna1 d.92.1.11 (A:106-263) Macrophage elastase (MMP-12) {Human (Homo sapiens) [TaxId: 9606]}
gpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfar
gahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslg
lghssdpkavmfptykyvdintfrlsaddirgiqslyg

SCOPe Domain Coordinates for d6ekna1:

Click to download the PDB-style file with coordinates for d6ekna1.
(The format of our PDB-style files is described here.)

Timeline for d6ekna1:

  • d6ekna1 appears in periodic updates to SCOPe 2.07 starting on 2018-05-17

View in 3D
Domains from same chain:
(mouse over for more information)
d6ekna2