Lineage for d6d72c1 (6d72 C:1-174)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2533209Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2533210Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2533769Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2533770Protein automated matches [190038] (43 species)
    not a true protein
  7. 2534197Species Yersinia pestis [TaxId:632] [337326] (2 PDB entries)
  8. 3052009Domain d6d72c1: 6d72 C:1-174 [352071]
    Other proteins in same PDB: d6d72b2, d6d72c2
    automated match to d4r9ma_
    complexed with ca, mli, peg

Details for d6d72c1

PDB Entry: 6d72 (more details), 2.17 Å

PDB Description: crystal structure of spermidine/spermine n-acetyltransferase speg from yersinia pestis in complex with calcium ions.
PDB Compounds: (C:) Spermidine n1-acetyltransferase

SCOPe Domain Sequences for d6d72c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6d72c1 d.108.1.0 (C:1-174) automated matches {Yersinia pestis [TaxId: 632]}
msttssvrlrpleredlpfvhqldnnasimrywfeepyeafvelcdlydkhihdqserrf
iiesqgtkiglvelveinhihrraefqiiidpthqgkgyagaaaklameygfsvlnlykl
ylivdkenekaihiysklgfeiegelkqeffingeyrtvirmcifqpqylakyk

SCOPe Domain Coordinates for d6d72c1:

Click to download the PDB-style file with coordinates for d6d72c1.
(The format of our PDB-style files is described here.)

Timeline for d6d72c1:

  • d6d72c1 appears in periodic updates to SCOPe 2.07 starting on 2018-05-17