Lineage for d6elac_ (6ela C:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2528985Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2528986Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2529558Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 2529736Protein Macrophage elastase (MMP-12) [69780] (1 species)
  7. 2529737Species Human (Homo sapiens) [TaxId:9606] [69781] (56 PDB entries)
    Uniprot P39900 106-263 ! Uniprot P39900 106-264
  8. 3052003Domain d6elac_: 6ela C: [352065]
    automated match to d5czma_
    complexed with b9z, ca, dio, edo, zn

Details for d6elac_

PDB Entry: 6ela (more details), 1.49 Å

PDB Description: crystal structure of mmp12 in complex with inhibitor be4.
PDB Compounds: (C:) Macrophage metalloelastase

SCOPe Domain Sequences for d6elac_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6elac_ d.92.1.11 (C:) Macrophage elastase (MMP-12) {Human (Homo sapiens) [TaxId: 9606]}
gpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfar
gahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslg
lghssdpkavmfptyayvdintfrlsaddirgiqslyg

SCOPe Domain Coordinates for d6elac_:

Click to download the PDB-style file with coordinates for d6elac_.
(The format of our PDB-style files is described here.)

Timeline for d6elac_:

  • d6elac_ appears in periodic updates to SCOPe 2.07 starting on 2018-05-17