Lineage for d6d43b_ (6d43 B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2413228Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 2413229Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 protein domains)
    automatically mapped to Pfam PF00121
  6. 2413230Protein Triosephosphate isomerase [51353] (20 species)
  7. 2413294Species Human (Homo sapiens) [TaxId:9606] [51355] (9 PDB entries)
  8. 3051995Domain d6d43b_: 6d43 B: [352057]
    automated match to d2jk2b_
    complexed with ipa

Details for d6d43b_

PDB Entry: 6d43 (more details), 2.04 Å

PDB Description: characterization of human triosephosphate isomerase s-nitrosylation
PDB Compounds: (B:) triosephosphate isomerase

SCOPe Domain Sequences for d6d43b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6d43b_ c.1.1.1 (B:) Triosephosphate isomerase {Human (Homo sapiens) [TaxId: 9606]}
srkffvggnwkmngrkqslgeligtlnaakvpadtevvcapptayidfarqkldpkiava
aqncykvtngaftgeispgmikdcgatwvvlghserrhvfgesdeligqkvahalaeglg
viacigekldereagitekvvfeqtkviadnvkdwskvvlayepvwaigtgktatpqqaq
evheklrgwlksnvsdavaqstriiyggsvtgatckelasqpdvdgflvggaslkpefvd
iinakq

SCOPe Domain Coordinates for d6d43b_:

Click to download the PDB-style file with coordinates for d6d43b_.
(The format of our PDB-style files is described here.)

Timeline for d6d43b_:

  • d6d43b_ appears in periodic updates to SCOPe 2.07 starting on 2018-05-17