Lineage for d6cwwb_ (6cww B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2565937Fold d.278: Ligand-binding domain in the NO signalling and Golgi transport [111125] (1 superfamily)
    an N-terminal helical bundle and the C-terminal alpha-beta(2)-alpha-beta(2) subdomain enclose a ligand-binding cavity
  4. 2565938Superfamily d.278.1: Ligand-binding domain in the NO signalling and Golgi transport [111126] (4 families) (S)
  5. 2565939Family d.278.1.1: H-NOX domain [111127] (2 proteins)
    binds heme between the N-terminal 4-helical bundle and the C-terminal alpha-beta(2)-alpha-beta(2) subdomains
    automatically mapped to Pfam PF07700
  6. 2565983Protein automated matches [191120] (2 species)
    not a true protein
  7. 3051991Species Caldanaerobacter subterraneus [TaxId:911092] [352053] (1 PDB entry)
  8. 3051992Domain d6cwwb_: 6cww B: [352054]
    automated match to d3tf0b_
    complexed with 211, hem; mutant

Details for d6cwwb_

PDB Entry: 6cww (more details), 1.85 Å

PDB Description: cs h-nox mutant with unnatural amino acid 4-cyano-l-phenylalanine at site 5
PDB Compounds: (B:) methyl-accepting chemotaxis protein

SCOPe Domain Sequences for d6cwwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cwwb_ d.278.1.1 (B:) automated matches {Caldanaerobacter subterraneus [TaxId: 911092]}
mkgtxvgtwiktlrdlygndvvdeslksvgwepdrvitpledidddevrrifakvsektg
knvneiwrevgrqniktfsewfpsyfagrrlvnflmmmdevhlqltkmikgatpprliak
pvakdaiemeyvskrkmydyflgliegsskffkeeisveevergekdgfsrlkvrikfkn
pvfey

SCOPe Domain Coordinates for d6cwwb_:

Click to download the PDB-style file with coordinates for d6cwwb_.
(The format of our PDB-style files is described here.)

Timeline for d6cwwb_:

  • d6cwwb_ appears in periodic updates to SCOPe 2.07 starting on 2018-05-17