Lineage for d6cdza_ (6cdz A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2536167Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 2536168Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 2536169Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 protein domains)
  6. 2536207Protein Thymidylate synthase [55833] (7 species)
  7. 2536222Species Escherichia coli [TaxId:562] [55834] (68 PDB entries)
  8. 3051987Domain d6cdza_: 6cdz A: [352049]
    automated match to d4iw5a_
    complexed with cb3, umc, ump; mutant

Details for d6cdza_

PDB Entry: 6cdz (more details), 2.4 Å

PDB Description: e. coli thymidylate synthase mutant i264am
PDB Compounds: (A:) Thymidylate synthase

SCOPe Domain Sequences for d6cdza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cdza_ d.117.1.1 (A:) Thymidylate synthase {Escherichia coli [TaxId: 562]}
mkqylelmqkvldegtqkndrtgtgtlsifghqmrfnlqdgfplvttkrchlrsiihell
wflqgdtniaylhennvtiwdewadengdlgpvygkqwrawptpdgrhidqittvlnqlk
ndpdsrriivsawnvgeldkmalapchaffqfyvadgklscqlyqrscdvflglpfnias
yallvhmmaqqcdlevgdfvwtggdthlysnhmdqthlqlsreprplpkliikrkpesif
dyrfedfeiegydphpgikapva

SCOPe Domain Coordinates for d6cdza_:

Click to download the PDB-style file with coordinates for d6cdza_.
(The format of our PDB-style files is described here.)

Timeline for d6cdza_:

  • d6cdza_ appears in periodic updates to SCOPe 2.07 starting on 2018-05-17