Lineage for d6amhc_ (6amh C:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2480698Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2480699Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2480700Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 protein domains)
  6. 2480954Protein automated matches [190054] (13 species)
    not a true protein
  7. 2480983Species Pyrococcus furiosus [TaxId:186497] [279274] (15 PDB entries)
  8. 3051968Domain d6amhc_: 6amh C: [352030]
    Other proteins in same PDB: d6amhb2
    automated match to d1v8zb_
    complexed with na, pls

Details for d6amhc_

PDB Entry: 6amh (more details), 1.63 Å

PDB Description: engineered tryptophan synthase b-subunit from pyrococcus furiosus, pftrpb4d11 with ser bound as e(aex1)
PDB Compounds: (C:) Tryptophan synthase beta chain 1

SCOPe Domain Sequences for d6amhc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6amhc_ c.79.1.1 (C:) automated matches {Pyrococcus furiosus [TaxId: 186497]}
mwfgefggqyvpetligplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt
ekiggakvylkredlvhggahktnnaigqallakfmgktrliaetgagqhgvatamagal
lgmkvdiymgaedverqkmnvfrmkllganvipvnsgsrtlkdainealrdwvatfeyth
yligsvvgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfv
ndkkvklvgveaggkglesgkhsaslnagqvgvshgmlsyflqdeegqikpshsiapgld
ypgvgpehaylkkiqraeyvavtdeealkafhelsrtegiipalesahavayamklakem
srdeiiivnlsgrgdkdldivlkvs

SCOPe Domain Coordinates for d6amhc_:

Click to download the PDB-style file with coordinates for d6amhc_.
(The format of our PDB-style files is described here.)

Timeline for d6amhc_:

  • d6amhc_ appears in periodic updates to SCOPe 2.07 starting on 2018-05-17