Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.0: automated matches [191404] (1 protein) not a true family |
Protein automated matches [190543] (131 species) not a true protein |
Species Geobacillus sp. [TaxId:1629723] [351942] (1 PDB entry) |
Domain d5xksf1: 5xks F:1-251 [352026] Other proteins in same PDB: d5xksa2, d5xksc2, d5xksf2 automated match to d3rm3a_ |
PDB Entry: 5xks (more details), 2.19 Å
SCOPe Domain Sequences for d5xksf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xksf1 c.69.1.0 (F:1-251) automated matches {Geobacillus sp. [TaxId: 1629723]} mtetypvvkgaepfffegndigilvlhgftgspqsmrplgeayheagytvcgprlkghgt hyedmekttcqdwidsveagyewlknrcgtifvtglsmggtltlymaehhpeicgiapin aainmpalagalagvgdlprfldaigsdikkpgvkelayektpaasirqivqlmervktd lhkitcpailfcsdedhvvppdnapfiydhiasadkklvrlpdsyhvatldndrqkiidt slaffkkhadr
Timeline for d5xksf1: