SCOPe 2.08: Domain d5xksf1: 5xks F:1-251

Lineage for d5xksf1 (5xks F:1-251)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (131 species)
   not a true protein

7. Species Geobacillus sp. [TaxId:1629723] [351942] (1 PDB entry)

8. Domain d5xksf1: 5xks F:1-251 [352026]
   Other proteins in same PDB: d5xksa2, d5xksc2, d5xksf2
   automated match to d3rm3a_

Details for d5xksf1

PDB Entry: 5xks, 2.19 Å

PDB Description: crystal structure of monoacylglycerol lipase from thermophilic geobacillus sp. 12amor

PDB Compounds: (F:) Thermostable monoacylglycerol lipase

SCOPe Domain Sequences for d5xksf1:

Sequence; same for both SEQRES and ATOM records:

>d5xksf1 c.69.1.0 (F:1-251) automated matches {Geobacillus sp. [TaxId: 1629723]}
mtetypvvkgaepfffegndigilvlhgftgspqsmrplgeayheagytvcgprlkghgt
hyedmekttcqdwidsveagyewlknrcgtifvtglsmggtltlymaehhpeicgiapin
aainmpalagalagvgdlprfldaigsdikkpgvkelayektpaasirqivqlmervktd
lhkitcpailfcsdedhvvppdnapfiydhiasadkklvrlpdsyhvatldndrqkiidt
slaffkkhadr

Timeline for d5xksf1:

• d5xksf1 first appeared in SCOPe 2.07