Lineage for d5vtad2 (5vta D:510-765)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2474355Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2474356Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2476490Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2476491Protein automated matches [190543] (105 species)
    not a true protein
  7. 2476970Species Norway rat (Rattus norvegicus) [TaxId:10116] [188292] (9 PDB entries)
  8. 3051961Domain d5vtad2: 5vta D:510-765 [352023]
    Other proteins in same PDB: d5vtaa1, d5vtab1, d5vtac1, d5vtad1, d5vtae1, d5vtae2, d5vtag_, d5vtaj_, d5vtal1, d5vtal2
    automated match to d4ffvb2
    complexed with 9k4, edo, nag, peg, pg4

Details for d5vtad2

PDB Entry: 5vta (more details), 2.8 Å

PDB Description: co-crystal structure of dppiv with a chemibody inhibitor
PDB Compounds: (D:) dipeptidyl peptidase 4

SCOPe Domain Sequences for d5vtad2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vtad2 c.69.1.0 (D:510-765) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mpskkldfivlnetrfwyqmilpphfdkskkypllidvyagpcsqkadaafrlnwatyla
steniivasfdgrgsgyqgdkimhainkrlgtlevedqieaarqflkmgfvdskrvaiwg
wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv
msraenfkqveyllihgtaddnvhfqqsaqiskalvdagvdfqamwytdedhgiasstah
qhiyshmshflqqcfs

SCOPe Domain Coordinates for d5vtad2:

Click to download the PDB-style file with coordinates for d5vtad2.
(The format of our PDB-style files is described here.)

Timeline for d5vtad2:

  • d5vtad2 appears in periodic updates to SCOPe 2.07 starting on 2018-05-10