Lineage for d5vtad1 (5vta D:39-509)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2399926Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
    consists of eight 4-stranded beta-sheet motifs; meander
    also found in some members of the WD40-repeat superfamily
  4. 2400039Superfamily b.70.3: DPP6 N-terminal domain-like [82171] (1 family) (S)
    automatically mapped to Pfam PF00930
  5. 2400040Family b.70.3.1: DPP6 N-terminal domain-like [82172] (3 protein domains)
    Pfam PF00930
  6. 2400311Protein automated matches [226889] (3 species)
    not a true protein
  7. 2400319Species Norway rat (Rattus norvegicus) [TaxId:10116] [225089] (8 PDB entries)
  8. 3051960Domain d5vtad1: 5vta D:39-509 [352022]
    Other proteins in same PDB: d5vtaa2, d5vtab2, d5vtac2, d5vtad2, d5vtae1, d5vtae2, d5vtag_, d5vtaj_, d5vtal1, d5vtal2
    automated match to d2gbca1
    complexed with 9k4, edo, nag, peg, pg4

Details for d5vtad1

PDB Entry: 5vta (more details), 2.8 Å

PDB Description: co-crystal structure of dppiv with a chemibody inhibitor
PDB Compounds: (D:) dipeptidyl peptidase 4

SCOPe Domain Sequences for d5vtad1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vtad1 b.70.3.1 (D:39-509) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rtytladylkntfrvksyslrwvsdseylykqennillfnaehgnssiflenstfeifgd
sisdysvspdrlfvlleynyvkqwrhsytasysiydlnkrqliteekipnntqwitwsqe
ghklayvwkndiyvkiephlpshritstgkenvifngindwvyeeeifgaysalwwspng
tflayaqfndtgvplieysfysdeslqypktvwipypkagavnptvkffivntdslsstt
ttipmqitapasvttgdhylcdvawvsedrislqwlrriqnysvmaicdydkttlvwncp
ttqehietsatgwcgrfrpaephftsdgssfykivsdkdgykhicqfqkdrkpeqvctfi
tkgawevisiealtsdylyyisneykempggrnlykiqltdhtnkkclscdlnpercqyy
svslskeakyyqlgcrgpglplytlhrstdqkelrvlednsaldkmlqdvq

SCOPe Domain Coordinates for d5vtad1:

Click to download the PDB-style file with coordinates for d5vtad1.
(The format of our PDB-style files is described here.)

Timeline for d5vtad1:

  • d5vtad1 appears in periodic updates to SCOPe 2.07 starting on 2018-05-10