Lineage for d5wnla_ (5wnl A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2546221Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2546222Protein automated matches [190417] (27 species)
    not a true protein
  7. 2547744Species Mouse (Mus musculus) [TaxId:10090] [194605] (29 PDB entries)
  8. 3051930Domain d5wnla_: 5wnl A: [351992]
    automated match to d3pp0b_
    complexed with cl, stu

Details for d5wnla_

PDB Entry: 5wnl (more details), 2.5 Å

PDB Description: crystal structure of murine receptor-interacting protein 4 (ripk4) d143n bound to staurosporine
PDB Compounds: (A:) Receptor-interacting serine/threonine-protein kinase 4

SCOPe Domain Sequences for d5wnla_:

Sequence, based on SEQRES records: (download)

>d5wnla_ d.144.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
algllrtfdagefagwekvgsggfgqvykvrhvhwktwlaikcspslhvddrermellee
akkmemakfryilpvygicqepvglvmeymetgslekllaseplpwdlrfrivhetavgm
nflhcmsppllhlnlkpanilldahyhvkisdfglakcngmshshdlsmdglfgtiaylp
perireksrlfdtkhdvysfaiviwgvltqkkpfadeknilhimmkvvkghrpelppicr
prpracasliglmqrcwhadpqvrptfqeitsetedlce

Sequence, based on observed residues (ATOM records): (download)

>d5wnla_ d.144.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
algllrtfdagefagwekvgsggfgqvykvrhvhwktwlaikcspvddrermelleeakk
memakfryilpvygicqepvglvmeymetgslekllaseplpwdlrfrivhetavgmnfl
hcmsppllhlnlkpanilldahyhvkisdfglakcfgtiaylpperireksrlfdtkhdv
ysfaiviwgvltqkkpfadeknilhimmkvvkghrpelppicrprpracasliglmqrcw
hadpqvrptfqeitsetedlce

SCOPe Domain Coordinates for d5wnla_:

Click to download the PDB-style file with coordinates for d5wnla_.
(The format of our PDB-style files is described here.)

Timeline for d5wnla_:

  • d5wnla_ appears in periodic updates to SCOPe 2.07 starting on 2018-05-10