Lineage for d5vsue_ (5vsu E:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2380450Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2380451Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2381067Family b.38.1.0: automated matches [191538] (1 protein)
    not a true family
  6. 2381068Protein automated matches [190914] (13 species)
    not a true protein
  7. 2381090Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [188389] (7 PDB entries)
  8. 3051923Domain d5vsue_: 5vsu E: [351985]
    Other proteins in same PDB: d5vsuc2
    automated match to d4c92e_

Details for d5vsue_

PDB Entry: 5vsu (more details), 3.1 Å

PDB Description: structure of yeast u6 snrnp with 2'-phosphate terminated u6 rna
PDB Compounds: (E:) U6 snRNA-associated Sm-like protein LSm5

SCOPe Domain Sequences for d5vsue_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vsue_ b.38.1.0 (E:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mslpeilplevidktinqkvlivlqsnrefegtlvgfddfvnviledavewlidpedesr
nekvmqhhgrmllsgnniailvpggkk

SCOPe Domain Coordinates for d5vsue_:

Click to download the PDB-style file with coordinates for d5vsue_.
(The format of our PDB-style files is described here.)

Timeline for d5vsue_:

  • d5vsue_ appears in periodic updates to SCOPe 2.07 starting on 2018-05-10