![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
![]() | Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) ![]() |
![]() | Family b.38.1.0: automated matches [191538] (1 protein) not a true family |
![]() | Protein automated matches [190914] (14 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [188389] (7 PDB entries) |
![]() | Domain d5vsuf_: 5vsu F: [351972] Other proteins in same PDB: d5vsuc2 automated match to d4c92f_ |
PDB Entry: 5vsu (more details), 3.1 Å
SCOPe Domain Sequences for d5vsuf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5vsuf_ b.38.1.0 (F:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} svtteflsdiigktvnvklasgllysgrlesidgfmnvalssatehyesnnnkllnkfns dvflrgtqvmyiseqki
Timeline for d5vsuf_: